| Protein or peptide name: | DWORF |
| Chromosome: | 3 |
| Protein or peptide start site: | 63483726 |
| Protein or peptide end site: | 63483827 |
| ncRNA start site: | 63481104 |
| ncRNA end site: | 63483906 |
| Genome Browser: | |
| Protein or peptide sequence: | MAEKESTSPHLMVPILLLVGWIVGCIIVIYIVFF |
| Protein or peptide length: | 34aa |
| ncRNA type: | lncRNA |
| ncRNA name: | Strit1 |
| Entrez ID: | 102637511 |
| Experimental species: | Mus musculus |
| Experimental techniques: | Northern blotting |
| Experimental sample (cell line and/or tissue): | Muscle |
| Description: | We discovered a putative muscle-specific long noncoding RNA that encodes a peptide of 34 amino acids and that we named dwarf open reading frame (DWORF). DWORF localizes to the SR membrane, where it enhances SERCA activity by displacing the SERCA inhibitors, phospholamban, sarcolipin, and myoregulin. |
| Subcellular location: | membrane |
| Function: | Conversely, slow skeletal muscle lacking DWORF exhibits delayed Ca2 clearance and relaxation and reduced SERCA activity. DWORF is the only endogenous peptide known to activate the SERCA pump by physical interaction and provides a means for enhancing muscle contractility. |
| Title of paper: | A peptide encoded by a transcript annotated as long noncoding RNA enhances SERCA activity in muscle |
| PMID: | 26816378 |
| Year of publication: | 2016 |
